PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 275aa    MW: 31271.9 Da    PI: 5.6901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1491genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++++G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D07G1491 14 KGPWTPEEDQILINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.35.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
      Gh_D07G1491  67 RGNFSREEEDTIINLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.919961IPR017930Myb domain
SuperFamilySSF466893.8E-3110108IPR009057Homeodomain-like
SMARTSM007172.1E-151363IPR001005SANT/Myb domain
PfamPF002498.5E-171461IPR001005SANT/Myb domain
CDDcd001674.70E-121661No hitNo description
PROSITE profilePS5129424.77662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2665116IPR009057Homeodomain-like
SMARTSM007173.3E-1466114IPR001005SANT/Myb domain
PfamPF002495.4E-1567112IPR001005SANT/Myb domain
CDDcd001674.64E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDQILINYIN LYGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SREEEDTIIN LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKPNH  120
GSIENKRQPK SNVDSSKDIK KEQQEPMNFL SPAVNAADNR PASPPESSSE VSTVTTSENN  180
SNMCMNKIET QEYVSEIDEN FWSEVLSADN SSIASDLQVA GSDQQLHSQY LPSSPLPKLE  240
TINDYGSNLY DTDTNMDFWY NLFARVGDLS ELPEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483245.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-80MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0D2PT150.0A0A0D2PT15_G
STRINGPOPTR_0002s03960.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-83myb domain protein 15